Products specifications
|
Antigen
|
Interleukin 6 (IL6)
|
|
Reactivity
|
Sheep
|
|
Host
|
Rabbit
|
|
NCBI Accession
|
RPA079Ov01
|
|
Concentration
|
200ug/ml
|
|
Conjugate
|
No Conjugate
|
|
Immunogen
|
Recombinant IL6 (Gly30~Lys208) expressed in E.coli.
|
|
Immunoglobulin Type
|
IgG
|
|
Purification
|
Affinity Chromatography
|
|
Specificity
|
The antibody is a rabbit polyclonal antibody raised against IL6. It has been selected for its ability to recognize IL6 in immunohistochemical staining and western blotting.
|
|
Application
|
WB, ICC, IHC-P, IHC-F, ELISA
|
|
Amino Acid Sequence
|
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-G PLGEDFKNDT TPSRLLLTTP EKTEALIKHI VDKISAIRKE ICEKNDECEN SKETLAENKL KLPKMEEKDG CFQSGFNQAI CLIKTTAGLL EYQIYLDFLQ NEFEGNQETV MELQSSIRTL IQILKEKIAG LITTPATHTD MLEKMQSSNE WVKNAKVIII LRSLENFLQF SLRAIRMK
|
|
Shipping Conditions
|
2 °C - 8 °C
|
|
Storage Temperature
|
Store at 4 °C for frequent use. Store at -20 °C to -80 °C for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
|
|
Handling Instruction
|
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
|
Notes
|
All antibodies are custom made on-demand. Please allow 5-7 working days for production and 2-3 days for shipment.
|
|
Legal Information
|
Marketed under license from USCN Life Science Inc.
|
Optimal working dilutions must be determined by end user.
| Western blotting | 1:100-400 |
| Immunocytochemistry in formalin fixed cells | 1:100-500 |
| Immunohistochemistry in formalin fixed frozen section | 1:100-500 |
| Immunohistochemistry in paraffin section | 1:50-200 |
| Enzyme-linked Immunosorbent Assay | 1:100-200 |